Table 1

Citrullinated peptides detected in collagen-induced arthritis joint tissue

Protein name

Accession number

Total score

Number of peptides

% coverage

cit peptide

p value


Tropomyosin 1α

[Genbank: 20522240]

1059

17

45

KLVIIESDLE(cit)AEER.A

0.039


Actin

[Genbank: 51316973]

539

10

43

RTTGIVLDSGDGVTHNVPIYEGYALPHAIM(cit)L

0.04


Calgranulin-B

[Genbank: 399173]

155

3

58

RSITTIIDTFHQYS(cit)K

0.1


ATP synthase β chain

[Genbank: 20455479]

1441

21

66

KGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLS(cit)A

0.012

KSLQDIIAILGMDELSEEDKLTVS(cit)A

9.3e-08

RIMNVIGEPIDE(cit)GPIKT

0.47


Kidd et al. Arthritis Research & Therapy 2008 10:R119   doi:10.1186/ar2523

Open Data